General Information

  • ID:  hor005463
  • Uniprot ID:  P68988
  • Protein name:  Insulin A chain
  • Gene name:  ins
  • Organism:  Lampetra fluviatilis (European river lamprey) (Petromyzon fluviatilis)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lampetra (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GIVEQCCHRKCSIYDMENYCN
  • Length:  21(37-57)
  • Propeptide:  SALTGAGGTHLCGSHLVEALYVVCGDRGFFYTPSKTGIVEQCCHRKCSIYDMENYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-P68988-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005463_AF2.pdbhor005463_ESM.pdb

Physical Information

Mass: 286579 Formula: C102H158N30O34S5
Absent amino acids: AFLPTW Common amino acids: C
pI: 5.54 Basic residues: 3
Polar residues: 10 Hydrophobic residues: 3
Hydrophobicity: -53.81 Boman Index: -4768
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50.95
Instability Index: 3381.9 Extinction Coefficient cystines: 3230
Absorbance 280nm: 161.5

Literature

  • PubMed ID:  8575665
  • Title:  Characterization of insulin, glucagon, and somatostatin from the river lamprey, Lampetra fluviatilis.